CJC-1295
CJC-1295 is a synthetic analog of growth hormone-releasing hormone (GHRH). Research studies its effects on growth hormone secretion, with particular interest in its extended half-life version (CJC-1295 with DAC).
Also known as: Modified GRF 1-29
Technical information
Molecular weight
3367.9 g/mol
Half-life
~30 min (no DAC), ~6-8 days (with DAC)
Sequence
Y-Aib-DAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL
Common research doses
1-2 mg/week (research protocols)
Research areas
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for CJC-1295
Ranked by PVS score — independent verification, no paid placements.
USA · 99.4 reported purity · 67+ CoAs
USA · yes reported purity · 64+ CoAs
USA · yes reported purity · 66+ CoAs
USA · 99.1% reported purity · 137+ CoAs
International · 99.0% reported purity · 53+ CoAs
Canada · 99.4% reported purity · 130+ CoAs
Canada · 99.3% reported purity · 58+ CoAs
EU · 99.3% reported purity · 131+ CoAs
USA · 99.2% reported purity · 97+ CoAs
USA · 99.2% reported purity · 135+ CoAs
EU · 99.1% reported purity · 67+ CoAs
USA · 99.2% reported purity · 134+ CoAs
UK · 99.1% reported purity · 116+ CoAs
USA · 99.1% reported purity · 86+ CoAs
USA · 99.2% reported purity · 97+ CoAs
UK · 99.3% reported purity · 148+ CoAs
EU · 99.2% reported purity · 99+ CoAs
UK · 99.0% reported purity · 140+ CoAs
Canada · 99.0% reported purity · 42+ CoAs
Canada · 99.4% reported purity · 58+ CoAs
Canada · 99.3% reported purity · 114+ CoAs
International · 99.2% reported purity · 61+ CoAs
USA · 99.2% reported purity · 73+ CoAs
Competitive landscape
Multi-signal comparison of every verified vendor selling CJC-1295 — PVS, purity, CoA cadence, sentiment, and 30-day momentum.
Market overview
Aggregate signals across vendors selling CJC-1295
Side-by-side comparison
All verified vendors selling CJC-1295. Click a column header to sort. ★ marks the leader on that column.
| Vendor | PVS | Purity | CoAs | Sentiment | 30d Δ | Lab | Price |
|---|---|---|---|---|---|---|---|
| 1Genetic Peptides USA | ★96 | — | ★0 | ★93 | 0.0 | — | — |
| 2Alder Bio Labs USA Made | 92 | — | ★0 | 0 | 0.0 | — | — |
| 3Peptiva Research Labs | 92 | — | ★0 | 90 | 0.0 | — | — |
| 4Chemical Planet | 80 | — | ★0 | 81 | 0.0 | — | — |
| 5Modern Aminos | 80 | — | ★0 | 81 | 0.0 | — | — |
| 6Ascension Peptides | 77 | — | ★0 | 92 | 0.0 | — | — |
| 7Limitless Life Nootropics | 60 | — | ★0 | 91 | 0.0 | — | — |
| 8Sports Technology Labs | 60 | — | ★0 | 90 | 0.0 | — | — |
| 9Loti Labs | 60 | — | ★0 | 84 | 0.0 | — | — |
| 10Biotech Peptides | 60 | — | ★0 | 83 | 0.0 | — | — |
| 11Pure Peptides USA | 60 | — | ★0 | 80 | 0.0 | — | — |
| 12Core Peptides | 52 | — | ★0 | 88 | -2.0 | — | — |
| 13Blue Sky Peptide | 51 | — | ★0 | 82 | 0.0 | — | — |
| 14Behemoth Labz | 51 | — | ★0 | 84 | 0.0 | — | — |
| 15Pure Rawz | 49 | — | ★0 | 86 | 0.0 | — | — |
| 16Swiss Chems | 41 | — | ★0 | 88 | 0.0 | — | — |
| 17Trident Peptides | 40 | — | ★0 | 89 | 0.0 | — | — |
| 18Direct Peptides | 34 | — | ★0 | 80 | 0.0 | — | — |
| 19PepChem | 33 | — | ★0 | 78 | 0.0 | — | — |
| 20Paradigm Peptides | 15 | — | ★0 | ★93 | 0.0 | — | — |
| 21Amino Asylum | 15 | — | ★0 | ★93 | ★+1.0 | — | — |
| 22Peptide Sciences | 15 | — | ★0 | 85 | -6.0 | — | — |
| 23Science.bio | 15 | — | ★0 | 82 | 0.0 | — | — |
Pillar leaders
Top-scoring vendor on each of the five PVS pillars
Recent purity track record
Approved community CoAs for CJC-1295, newest first