CJC-1295
CJC-1295 is a synthetic analog of growth hormone-releasing hormone (GHRH). Research studies its effects on growth hormone secretion, with particular interest in its extended half-life version (CJC-1295 with DAC).
Also known as: Modified GRF 1-29
Technical information
Molecular weight
3367.9 g/mol
Half-life
~30 min (no DAC), ~6-8 days (with DAC)
Sequence
Y-Aib-DAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL
Common research doses
1-2 mg/week (research protocols)
Research areas
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for CJC-1295
Ranked by PVS score — independent verification, no paid placements.
USA · 99.4% reported purity · 62+ CoAs
Canada · 99.4% reported purity · 58+ CoAs
Canada · 99.4% reported purity · 130+ CoAs
Canada · 99.3% reported purity · 58+ CoAs
USA · yes reported purity · 25+ CoAs
USA · yes reported purity · 26+ CoAs
Canada · 99.3% reported purity · 114+ CoAs
EU · 99.3% reported purity · 131+ CoAs
UK · 99.3% reported purity · 148+ CoAs
EU · 99.2% reported purity · 99+ CoAs
USA · 99.2% reported purity · 134+ CoAs
USA · 99.2% reported purity · 97+ CoAs
USA · 99.2% reported purity · 97+ CoAs
USA · 99.2% reported purity · 135+ CoAs
USA · 99.2% reported purity · 73+ CoAs
UK · 99.1% reported purity · 116+ CoAs
USA · 99.1% reported purity · 86+ CoAs
EU · 99.1% reported purity · 67+ CoAs
USA · 99.1% reported purity · 137+ CoAs
International · 99.0% reported purity · 53+ CoAs
UK · 99.0% reported purity · 140+ CoAs
Canada · 99.0% reported purity · 42+ CoAs
Competitive landscape
Multi-signal comparison of every verified vendor selling CJC-1295 — PVS, purity, CoA cadence, sentiment, and 30-day momentum.
Market overview
Aggregate signals across vendors selling CJC-1295
Side-by-side comparison
All verified vendors selling CJC-1295. Click a column header to sort. ★ marks the leader on that column.
| Vendor | PVS | Purity | CoAs | Sentiment | 30d Δ | Lab | Price |
|---|---|---|---|---|---|---|---|
| 1Genetic Peptides USA | ★94 | — | ★0 | ★93 | ★0.0 | Janoshik | $ |
| 2Paradigm Peptides | ★94 | — | ★0 | ★93 | ★0.0 | Janoshik | $$$ |
| 3Ascension Peptides | 93 | — | ★0 | 92 | ★0.0 | Janoshik | $$$ |
| 4Limitless Life Nootropics | 92 | — | ★0 | 91 | ★0.0 | Janoshik | $$ |
| 5Alder Bio Labs USA Made | 92 | — | ★0 | 0 | ★0.0 | Janoshik | $$$ |
| 6Peptiva Research Labs | 92 | — | ★0 | 90 | ★0.0 | Janoshik | $$$ |
| 7Amino Asylum | 91 | — | ★0 | ★93 | ★0.0 | Janoshik | $ |
| 8Sports Technology Labs | 90 | — | ★0 | 90 | ★0.0 | Janoshik | $ |
| 9Swiss Chems | 89 | — | ★0 | 88 | ★0.0 | Janoshik | $ |
| 10Trident Peptides | 88 | — | ★0 | 89 | ★0.0 | Janoshik | $$ |
| 11Core Peptides | 87 | — | ★0 | 88 | ★0.0 | Janoshik | $$$ |
| 12Pure Rawz | 85 | — | ★0 | 86 | ★0.0 | Janoshik | $ |
| 13Loti Labs | 85 | — | ★0 | 84 | ★0.0 | Janoshik | $ |
| 14Biotech Peptides | 84 | — | ★0 | 83 | ★0.0 | Janoshik | $$ |
| 15Science.bio | 83 | — | ★0 | 82 | ★0.0 | Janoshik | $ |
| 16Blue Sky Peptide | 83 | — | ★0 | 82 | ★0.0 | Janoshik | $ |
| 17Behemoth Labz | 82 | — | ★0 | 84 | ★0.0 | Janoshik | $$$ |
| 18Pure Peptides USA | 81 | — | ★0 | 80 | ★0.0 | Janoshik | $$ |
| 19Chemical Planet | 80 | — | ★0 | 81 | ★0.0 | Janoshik | $$ |
| 20Modern Aminos | 80 | — | ★0 | 81 | ★0.0 | Janoshik | $ |
| 21Direct Peptides | 79 | — | ★0 | 80 | ★0.0 | Janoshik | $$ |
| 22PepChem | 77 | — | ★0 | 78 | ★0.0 | Janoshik | $ |
Pillar leaders
Top-scoring vendor on each of the five PVS pillars
Recent purity track record
Approved community CoAs for CJC-1295, newest first