Tesamorelin
Tesamorelin is a stabilized analog of growth hormone-releasing hormone (GHRH) that stimulates endogenous GH secretion from the pituitary. It has been studied extensively in the context of visceral adipose tissue research.
Also known as: TH9507, Egrifta
Technical information
Molecular weight
5195.8 g/mol
Half-life
~26 minutes (subcutaneous)
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Common research doses
1-2 mg/day (research protocols)
Research areas
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for Tesamorelin
Ranked by PVS score — independent verification, no paid placements.
Competitive landscape
Multi-signal comparison of every verified vendor selling Tesamorelin — PVS, purity, CoA cadence, sentiment, and 30-day momentum.
Market overview
Aggregate signals across vendors selling Tesamorelin
Side-by-side comparison
All verified vendors selling Tesamorelin. Click a column header to sort. ★ marks the leader on that column.
| Vendor | PVS | Purity | CoAs | Sentiment | 30d Δ | Lab | Price |
|---|---|---|---|---|---|---|---|
| 1Alder Bio Labs USA Made | ★92 | — | ★0 | 0 | ★0.0 | — | — |
| 2Peptiva Research Labs | ★92 | — | ★0 | ★90 | ★0.0 | — | — |
Pillar leaders
Top-scoring vendor on each of the five PVS pillars
Recent purity track record
Approved community CoAs for Tesamorelin, newest first
- Genetic Peptides USA——3mo ago
- Revitalized Research——4mo ago
- ELVTD Products——4mo ago
- ELVTD Products——4mo ago
- Platinum Biolabs——5mo ago
- Platinum Biolabs——5mo ago