Skip to content
All peptides
Growth HormoneResearch peptide

Tesamorelin

Tesamorelin is a stabilized analog of growth hormone-releasing hormone (GHRH) that stimulates endogenous GH secretion from the pituitary. It has been studied extensively in the context of visceral adipose tissue research.

Also known as: TH9507, Egrifta

Technical information

Molecular weight

5195.8 g/mol

Half-life

~26 minutes (subcutaneous)

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Common research doses

1-2 mg/day (research protocols)

Research areas

GHRH analogVisceral fat researchIGF-1 studiesBody composition

For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.

Best Verified Vendors for Tesamorelin

Ranked by PVS score — independent verification, no paid placements.

Competitive landscape

Multi-signal comparison of every verified vendor selling Tesamorelin — PVS, purity, CoA cadence, sentiment, and 30-day momentum.

Market overview

Aggregate signals across vendors selling Tesamorelin

30d
Verified vendors
2
selling this peptide
Median PVS
across vendors above
Avg reported purity
no community CoAs yet
CoAs on record
0
approved community submissions

Side-by-side comparison

All verified vendors selling Tesamorelin. Click a column header to sort. ★ marks the leader on that column.

VendorPVSPurityCoAsSentiment30d ΔLabPrice
1Alder Bio Labs USA Made000Janoshik$$$
2Peptiva Research Labs000Janoshik$$$

Recent purity track record

Approved community CoAs for Tesamorelin, newest first

No community CoAs have been submitted for this peptide yet.